Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZRANB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZRANB2 antibody: synthetic peptide directed towards the middle region of human ZRANB2. Synthetic peptide located within the following region: EDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNKKKS |
Rabbit Polyclonal Anti-ZRANB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZRANB2 Antibody: synthetic peptide directed towards the N terminal of human ZRANB2. Synthetic peptide located within the following region: KTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESD |
Rabbit Polyclonal Anti-ZNF265 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF265 Antibody: synthetic peptide directed towards the N terminal of human ZNF265. Synthetic peptide located within the following region: RCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARR |
Rabbit Polyclonal Anti-ZRANB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZRANB2 antibody: synthetic peptide directed towards the middle region of human ZRANB2. Synthetic peptide located within the following region: GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED |
Rabbit Polyclonal Anti-ZRANB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZRANB2 antibody: synthetic peptide directed towards the middle region of human ZRANB2. Synthetic peptide located within the following region: SILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEED |
Rabbit Polyclonal Anti-ZRANB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZRANB2 antibody: synthetic peptide directed towards the middle region of human ZRANB2. Synthetic peptide located within the following region: ILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDS |
Rabbit Polyclonal Anti-ZNF265 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF265 Antibody: A synthesized peptide derived from human ZNF265 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ZRANB2
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transcription Factors