Antibodies

View as table Download

Rabbit Polyclonal Antibody against TARDBP

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Primate, Mouse, Xenopus, Zebrafish, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148]

Rabbit polyclonal TARDBP Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken)
Conjugation Unconjugated
Immunogen This TARDBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TARDBP.

Rabbit Polyclonal Anti-TARDBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the C terminal of human TARDBP. Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG

Rabbit Polyclonal Anti-TARDBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC

Rabbit Polyclonal Anti-TARDBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the middle region of human TARDBP. Synthetic peptide located within the following region: GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN

Rabbit Polyclonal Anti-TARDBP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK

Rabbit anti-TARDBP Polyclonal Antibody

Applications IP, RIP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TARDBP

Rabbit Anti-TDP43 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues C-terminal to the caspase-cleavage site (between D219 and V220) of human TDP-43.