Germany
Japan
United Kingdom
China
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Antibodies
View as table Download
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal Anti-OTX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal Antibody against CD9 (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Embryonic stem cells
Filter by
Target Symbol
- SMAD3 (18)
- SMAD2 (17)
- C-MYC (14)
- FGF4 (12)
- OCT4 (11)
- SOX2 (11)
- CD117 (10)
- HNF1 BETA (10)
- EGF (9)
- SOX9 (9)
- BDNF (8)
- DNMT3B (8)
- GATA4 (8)
- KLF4 (8)
- FOXA2 (7)
- NANOG (7)
- NEUROD1 (7)
- IGFBP1 (6)
- PAX7 (6)
- PROX1 (6)
- BMP2 (5)
- BMP7 (5)
- CD44 (5)
- CD9 (5)
- CDX2 (5)
- PAX3 (5)
- PDGFC (5)
- PDX1 (5)
- REX1 (5)
- BMP6 (4)
- GRB7 (4)
- IGFBP2 (4)
- PAX6 (4)
- CRIPTO1 (3)
- GATA6 (3)
- GDF 5 (3)
- GDF 9 (3)
- KLF5 (3)
- OTX2 (3)
- PAX4 (3)
- BMP15 (2)
- BMP5 (2)
- BMP8B (2)
- BXDC2 (2)
- CD14 (2)
- CD34 (2)
- EOMES (2)
- GDF3 (2)
- GDF7 (2)
- GLI1 (2)
- GLI2 (2)
- NODAL (2)
- PTF1A (2)
- TAT (2)
- BMP4 (1)
- CCN4 (1)
- DPPA2 (1)
- FGF10 (1)
- FGF19 (1)
- GLI3 (1)
- HBZ (1)
- KGF (1)
- UTF1 (1)
- ZIC3 (1)
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (94)
- TGF-beta signaling pathway (75)
- Cell cycle (49)
- Colorectal cancer (49)
- Wnt signaling pathway (49)
- MAPK signaling pathway (48)
- Pancreatic cancer (44)
- Cytokine-cytokine receptor interaction (37)
- Maturity onset diabetes of the young (36)
- Adherens junction (35)
- Chronic myeloid leukemia (32)
- Regulation of actin cytoskeleton (31)
- Acute myeloid leukemia (29)
- Hematopoietic cell lineage (29)
- Melanoma (29)
- Endocytosis (24)
- Hedgehog signaling pathway (24)
- Bladder cancer (23)
- Endometrial cancer (23)
- ErbB signaling pathway (23)
- Melanogenesis (15)
- Focal adhesion (14)
- Gap junction (14)
- Jak-STAT signaling pathway (14)
- Prostate cancer (14)
- Small cell lung cancer (14)
- Thyroid cancer (14)
- Basal cell carcinoma (11)
- Cysteine and methionine metabolism (10)
- Metabolic pathways (10)
- Glioma (9)
- Non-small cell lung cancer (9)
- Huntington's disease (8)
- Neurotrophin signaling pathway (8)
- ECM-receptor interaction (5)
- Type II diabetes mellitus (5)
- Cell adhesion molecules (CAMs) (2)
- Pathogenic Escherichia coli infection (2)
- Phenylalanine (2)
- Phenylalanine metabolism (2)
- Toll-like receptor signaling pathway (2)
- Tyrosine metabolism (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- tyrosine and tryptophan biosynthesis (2)