Rabbit Polyclonal Gli1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151] |
Rabbit Polyclonal Gli1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151] |
Anti-PDX1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1 |
Anti-IGFBP1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 237-249 amino acids of human insulin-like growth factor binding protein 1 |
Rabbit Polyclonal Anti-proBDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein. |
Rabbit Polyclonal anti-GLI2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-BMP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP6 |
Rabbit Polyclonal Anti-CDX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDX2 |
Anti-TAT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-SMAD3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMAD3 |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
Rabbit Polyclonal Anti-PAX7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Rabbit Polyclonal BMP-2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
KLF4 Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KLF4 |
Rabbit Polyclonal CRIPTO Antibody
Applications | FC, ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of mouse Cripto1 (between residues 1-50). [UniProt# P51865] |