Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-IGFBP1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 237-249 amino acids of human insulin-like growth factor binding protein 1 |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Active filters
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Embryonic stem cells
Filter by
Category
Target Symbol
- SMAD2 (17)
- SMAD3 (16)
- C-MYC (13)
- SOX2 (9)
- CD117 (8)
- GATA4 (8)
- SOX9 (8)
- BDNF (6)
- FGF4 (6)
- OCT4 (6)
- PROX1 (6)
- CDX2 (5)
- DNMT3B (5)
- HNF1 BETA (5)
- BMP2 (4)
- CD44 (4)
- FOXA2 (4)
- KLF4 (4)
- NANOG (4)
- NEUROD1 (4)
- PAX3 (4)
- PDGFC (4)
- PDX1 (4)
- EGF (3)
- BMP6 (2)
- BMP7 (2)
- CD34 (2)
- CD9 (2)
- GLI1 (2)
- IGFBP1 (2)
- IGFBP2 (2)
- KLF5 (2)
- PAX6 (2)
- PAX7 (2)
- BMP15 (1)
- BMP4 (1)
- BMP5 (1)
- CRIPTO1 (1)
- FGF10 (1)
- GATA6 (1)
- GDF 5 (1)
- GDF 9 (1)
- GDF3 (1)
- GDF7 (1)
- GLI2 (1)
- GRB7 (1)
- NODAL (1)
- OTX2 (1)
- PTF1A (1)
- TAT (1)
- ZIC3 (1)
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (72)
- TGF-beta signaling pathway (59)
- Cell cycle (46)
- Colorectal cancer (46)
- Wnt signaling pathway (46)
- Pancreatic cancer (36)
- Adherens junction (33)
- Chronic myeloid leukemia (29)
- MAPK signaling pathway (29)
- Acute myeloid leukemia (25)
- Cytokine-cytokine receptor interaction (22)
- Hematopoietic cell lineage (20)
- Maturity onset diabetes of the young (19)
- Bladder cancer (16)
- Endometrial cancer (16)
- ErbB signaling pathway (16)
- Endocytosis (15)
- Melanoma (14)
- Regulation of actin cytoskeleton (14)
- Hedgehog signaling pathway (13)
- Jak-STAT signaling pathway (13)
- Small cell lung cancer (13)
- Thyroid cancer (13)
- Melanogenesis (12)
- Basal cell carcinoma (8)
- Focal adhesion (7)
- Gap junction (7)
- Prostate cancer (7)
- Cysteine and methionine metabolism (6)
- Huntington's disease (6)
- Metabolic pathways (6)
- Neurotrophin signaling pathway (6)
- ECM-receptor interaction (4)
- Type II diabetes mellitus (4)
- Glioma (3)
- Non-small cell lung cancer (3)
- Cell adhesion molecules (CAMs) (2)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Tyrosine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)