Antibodies

Jump to Filters
View as table Download
HSPA4 Rabbit Polyclonal Antibody
TA349855

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA4
CD4 Rabbit Polyclonal Antibody
TA590039

USD 482.00

In Stock

Rabbit Polyclonal CD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
HSPA4 Rabbit Polyclonal Antibody
TA339252

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4. Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
HSPA4 Rabbit Polyclonal Antibody
TA339251

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4. Synthetic peptide located within the following region: PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
CD8A Rabbit Polyclonal Antibody
TA347876

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A