Rabbit Polyclonal Anti-RNF34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF34 antibody: synthetic peptide directed towards the middle region of human RNF34. Synthetic peptide located within the following region: LVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSS |
Rabbit polyclonal anti-RNF34 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-373 of human RNF34 protein. |
RNF34 rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein corresponding to amino acids 1-373 of human RFI. |
Germany
Japan
United Kingdom
China