MCCC2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human MCCC2. |
MCCC2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human MCCC2. |
Rabbit Polyclonal Anti-MCCC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MCCC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MCCC2. Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR |
Rabbit Polyclonal Anti-MCCC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MCCC2 antibody is: synthetic peptide directed towards the N-terminal region of Human MCCC2. Synthetic peptide located within the following region: LPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGIITGIGRVSGVEC |
MCCC2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MCCC2 |