Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-SFRP1 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | SFRP1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a 12 aa region of human Sfrp1 protein. |
Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit Polyclonal Cyclin D1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286. |
Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DKK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DKK2 |
Rabbit Polyclonal Cyclin D1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Myc (Ser62) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Serine 62 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Rabbit Polyclonal Anti-MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1 |
Active filters
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Stem cell relevant signaling - Wnt Signaling pathway
Filter by
Category
Target Symbol
Modifications
Pathways
- Pathways in cancer (34)
- Wnt signaling pathway (32)
- Chronic myeloid leukemia (19)
- MAPK signaling pathway (14)
- Acute myeloid leukemia (13)
- Bladder cancer (13)
- Cell cycle (13)
- Colorectal cancer (13)
- Endometrial cancer (13)
- Jak-STAT signaling pathway (13)
- Small cell lung cancer (13)
- Thyroid cancer (13)
- Melanoma (11)
- Basal cell carcinoma (9)
- Hedgehog signaling pathway (9)
- Melanogenesis (9)
- ErbB signaling pathway (8)
- TGF-beta signaling pathway (8)
- Notch signaling pathway (6)
- Regulation of actin cytoskeleton (6)
- Focal adhesion (5)
- Glioma (5)
- Non-small cell lung cancer (5)
- Pancreatic cancer (5)
- Prostate cancer (5)
- Viral myocarditis (5)
- p53 signaling pathway (5)