Antibodies

View as table Download

Anti-PLAUR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-305 amino acids of human plasminogen activator, urokinase receptor

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue
TA321237 is a possible alternative to TA321238.

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal antibody to Thrombomodulin (thrombomodulin)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 512 and 575 of Thrombomodulin (Uniprot ID#P07204)

Rabbit Polyclonal Anti-C4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.

Rabbit anti-SERPIND1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPIND1

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS