Antibodies

Jump to Filters
View as table Download
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA314800

USD 380.00

2 Weeks

Rabbit polyclonal anti-ABCC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC3.
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA313641

USD 380.00

In Stock

Rabbit polyclonal anti-ABCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC2.
MRP4 (ABCC4) Rabbit Polyclonal Antibody
TA327332

USD 365.00

3 Weeks

ABCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4
ABCG2 Rabbit Polyclonal Antibody
TA322704

USD 380.00

Backordered

Anti-ABCG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2
TA322704 is a possible alternative to TA324234.
ABCB4 Rabbit Polyclonal Antibody
TA346193

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
ABCD2 Rabbit Polyclonal Antibody
TA308846

USD 625.00

In Stock

Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)

Applications WB
Reactivities Human (Predicted: Mouse, Chicken, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2)
ABCG2 Rabbit Polyclonal Antibody
TA347825

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ABCG2(CD338) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338).
PMP70 (ABCD3) Rabbit Polyclonal Antibody
TA310030

USD 285.00

3 Weeks

Rabbit anti-ABCD3 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCD3.
ABCB8 Rabbit Polyclonal Antibody
TA322438

USD 380.00

In Stock

Anti-ABCB8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8