Antibodies

View as table Download

Rabbit Polyclonal Anti-HDAC8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HDAC8

HDAC8 pSer39 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

HDAC8 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 2-45 of Human HDAC8.

HDAC8 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human HDAC8.

Rabbit Polyclonal HDAC8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC8

Rabbit Polyclonal HDAC8 (Ser39) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC8 around the phosphorylation site of Serine 39
Modifications Phospho-specific

Rabbit anti-HDAC8 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HDAC8

Rabbit Polyclonal Anti-HDAC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the C terminal of human HDAC8. Synthetic peptide located within the following region: TGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNY

HDAC8 Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HDAC8

HDAC8 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-HDAC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the N terminal of human HDAC8. Synthetic peptide located within the following region: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYAL