Rabbit Polyclonal antibody to GRAP (GRB2-related adaptor protein)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 155 and 217 of GRAP (Uniprot ID#Q13588) |
Rabbit Polyclonal Anti-GRAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRAP antibody is: synthetic peptide directed towards the N-terminal region of Human GRAP. Synthetic peptide located within the following region: SDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSG |
Rabbit Polyclonal Anti-GRAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRAP antibody: synthetic peptide directed towards the middle region of human GRAP. Synthetic peptide located within the following region: KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD |
Grap Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
GRAP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-217 of human GRAP (NP_006604.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
