Germany
Japan
United Kingdom
China
Antibodies
View as table Download
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-YAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
Rabbit polyclonal anti-YAP antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human YAP. |
Rabbit Polyclonal YAP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human YAP |
Rabbit Polyclonal YAP (Ser127) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human YAP around the phosphorylation site of Serine 127 |
| Modifications | Phospho-specific |
YAP1 pSer127 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine127(A-H-S(p)-S-P) derived from Human YAP (KLH-conjugated) |
Active filters
Category
- Antibodies
Target Symbol
- YAP1
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit