Rabbit Polyclonal Anti-NOX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2. |
Rabbit Polyclonal Anti-NOX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2. |
Rabbit anti-CYBB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYBB |
Rabbit Polyclonal Anti-CYBB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |