Antibodies

Jump to Filters
View as table Download
UBE2C Rabbit Polyclonal Antibody
TA332727

USD 365.00

3 Weeks

Rabbit anti-UBE2C Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2C
UBE2C Rabbit Polyclonal Antibody
TA329810

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the N terminal of human UBE2C. Synthetic peptide located within the following region: ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS
UBE2C Rabbit Polyclonal Antibody
TA329811

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP
UBE2C Rabbit Polyclonal Antibody
TA331549

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBE2C Antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ