Rabbit Polyclonal Anti-CUL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUL3 |
Rabbit Polyclonal Anti-CUL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUL3 |
Rabbit Polyclonal Anti-CUL3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CUL3 antibody: synthetic peptide directed towards the C terminal of human CUL3. Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS |
Rabbit polyclonal antibody to CUL-3 (cullin 3)
Applications | WB |
Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 352 and 656 of Cullin 3 (Uniprot ID#Q13618) |
Rabbit anti-CUL3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CUL3 |