Antibodies

View as table Download

Rabbit Polyclonal Anti-CUL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CUL3

Rabbit Polyclonal Anti-CUL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL3 antibody: synthetic peptide directed towards the C terminal of human CUL3. Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS

Rabbit polyclonal antibody to CUL-3 (cullin 3)

Applications WB
Reactivities Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 352 and 656 of Cullin 3 (Uniprot ID#Q13618)

Rabbit anti-CUL3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL3