Antibodies

View as table Download

TOLLIP Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TOLLIP

Rabbit polyclonal anti-TOLLIP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TOLLIP.

Rabbit Polyclonal anti-TOLLIP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOLLIP antibody: synthetic peptide directed towards the C terminal of human TOLLIP. Synthetic peptide located within the following region: MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG