Antibodies

Jump to Filters
View as table Download
Ribonuclease H2, subunit A (RNASEH2A) Rabbit Polyclonal Antibody
TA306706

USD 570.00

2 Weeks

Rabbit Polyclonal RNAse H2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RNAse H2A antibody was raised against a 17 amino acid peptide near the center of human RNAse H2A.
Ribonuclease H2, subunit A (RNASEH2A) Rabbit Polyclonal Antibody
TA345963

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-RNASEH2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the middle region of human RNASEH2A. Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
Ribonuclease H2, subunit A (RNASEH2A) Rabbit Polyclonal Antibody
TA345962

USD 539.00

5 Days

Rabbit Polyclonal Anti-RNASEH2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the C terminal of human RNASEH2A. Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES