Antibodies

Jump to Filters
View as table Download
PSME2 Rabbit Polyclonal Antibody
TA332767

USD 450.00

3 Weeks

Rabbit anti-PSME2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME2
PSME2 Rabbit Polyclonal Antibody
TA342178

USD 539.00

5 Days

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH
PSME2 Rabbit Polyclonal Antibody
TA342179

USD 539.00

5 Days

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV