Antibodies

View as table Download

Rabbit polyclonal antibody to FPGT (fucose-1-phosphate guanylyltransferase)

Applications IHC, WB
Reactivities Human (Predicted: Dog, Monkey, Pig, Rabbit, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 146 and 453 of FPGT (Uniprot ID#O14772)

Rabbit Polyclonal Anti-FPGT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FPGT antibody is: synthetic peptide directed towards the C-terminal region of Human FPGT. Synthetic peptide located within the following region: TSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIP