Rabbit Polyclonal Anti-POLE4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV |
Rabbit Polyclonal Anti-POLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 Antibody: A synthesized peptide derived from human MCM5 |
Rabbit Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
Rabbit Polyclonal Anti-DNA Polymerase a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNA Polymerase a Antibody: A synthesized peptide derived from human DNA Polymerase a |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
| Modifications | Phospho-specific |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
| Modifications | Phospho-specific |
Rabbit anti-MCM2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM2 |
Germany
Japan
United Kingdom
China