Antibodies

View as table Download

Rabbit polyclonal EXT2 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2.

EXT1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EXT1

Rabbit Polyclonal Anti-EXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXT2 antibody: synthetic peptide directed towards the N terminal of human EXT2. Synthetic peptide located within the following region: NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW

Rabbit Polyclonal Anti-HS3ST3B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1. Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Rabbit Polyclonal Anti-XYLT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the middle region of human XYLT2. Synthetic peptide located within the following region: PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Rabbit Polyclonal Anti-XYLT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the C terminal of human XYLT2. Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Rabbit anti-B3GAT1 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human CD57.

Rabbit Polyclonal Anti-XYLT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF

Rabbit polyclonal Anti-HS6ST3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HS6ST3 antibody: synthetic peptide directed towards the C terminal of human HS6ST3. Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Rabbit polyclonal Anti-HS3ST5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS3ST5 antibody: synthetic peptide directed towards the C terminal of human HS3ST5. Synthetic peptide located within the following region: SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH

Rabbit Polyclonal Anti-B3GAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GAT1 antibody is: synthetic peptide directed towards the N-terminal region of Human B3GAT1. Synthetic peptide located within the following region: LAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPP

Rabbit Polyclonal Anti-HS6ST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HS6ST2 Antibody is: synthetic peptide directed towards the C-terminal region of Human HS6ST2. Synthetic peptide located within the following region: QNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND

Rabbit Polyclonal Anti-NDST4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the N terminal of human NDST4. Synthetic peptide located within the following region: EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ

Rabbit Polyclonal Anti-NDST4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the middle region of human NDST4. Synthetic peptide located within the following region: YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS

Rabbit Polyclonal Anti-NDST3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDST3 antibody: synthetic peptide directed towards the N terminal of human NDST3. Synthetic peptide located within the following region: PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD