Antibodies

Jump to Filters
View as table Download
WIF1 Rabbit Polyclonal Antibody
TA332658

USD 365.00

3 Weeks

Rabbit anti-WIF1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WIF1
WIF1 Rabbit Polyclonal Antibody
TA340160

USD 539.00

5 Days

Rabbit Polyclonal Anti-WIF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WIF1 antibody: synthetic peptide directed towards the N terminal of human WIF1. Synthetic peptide located within the following region: RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN