Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA313319

USD 380.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
TA350853

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACE
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody
AP54230PU-N

USD 580.00

2 Weeks

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA356540

USD 539.00

5 Days

TGFB2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody
TA325932

USD 380.00

4 Weeks

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA310081

USD 360.00

3 Weeks

Rabbit anti-TGFB1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide coupled to KLH
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA890046

USD 407.00

4 Weeks

Rabbit polyclonal anti-TGFB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TGFB2
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
AP20608PU-N

USD 465.00

3 Weeks

Angiotensin Converting Enzyme 1 (ACE) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA890046S

USD 188.00

4 Weeks

Rabbit polyclonal anti-TGFB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TGFB2
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
TA323567

USD 380.00

In Stock

Anti-ACE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme
IGF1 Rabbit Polyclonal Antibody
TA332383

USD 365.00

3 Weeks

Rabbit anti-IGF1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human IGF1
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA342296

USD 485.00

5 Days

Rabbit Polyclonal Anti-Tgfb1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody
TA314618

USD 380.00

In Stock

Rabbit polyclonal anti-TGF beta3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β3.