Antibodies

Jump to Filters
View as table Download
GABA A Receptor gamma 2 (GABRG2) Rabbit Polyclonal Antibody
TA338795

USD 485.00

5 Days

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the C terminal of human GABRG2. Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
GABA A Receptor gamma 1 (GABRG1) Rabbit Polyclonal Antibody
TA347776

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GABRG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRG1 Antibody: A synthesized peptide derived from human GABRG1