Antibodies

Jump to Filters
View as table Download
CHRNA9 Rabbit Polyclonal Antibody
TA371739

USD 380.00

4 Weeks

CHRNA9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA9
CHRNA9 Rabbit Polyclonal Antibody
TA330425

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHRNA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
CHRNA9 Rabbit Polyclonal Antibody
TA355759

USD 539.00

5 Days

CHRNA9 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHRNA9 antibody is: synthetic peptide directed towards the N-terminal region of Human ACHA9
CHRNA9 Rabbit Polyclonal Antibody
TA374777

USD 365.00

3 Weeks

CHRNA9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-240 of human CHRNA9 (NP_060051.2).
Modifications Unmodified