Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit polyclonal antibody to AIF1 (allograft inflammatory factor 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Bovine, Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 85 and 147 of Iba1 (Uniprot ID#P55008) |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit polyclonal antibody to Calretinin (calbindin 2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 271 of Calretinin (Uniprot ID#P22676) |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit Polyclonal antibody to SOCS5 (suppressor of cytokine signaling 5)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Pig, Chicken, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 1 and 42 of SOCS5 |
Rabbit polyclonal ATG5 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Phospho-AMPK alpha 1/2 (Thr183/Thr172) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human AMPK alpha around the phosphorylation site of Thr172. AA range:140-189 (Phosphorylated) |
Germany
Japan
United Kingdom
China
