Antibodies

View as table Download

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Anti-IL18 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
TA324190 is a possible alternative to TA324189.

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal TRAF6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRAF6 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human TRAF6.

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit Polyclonal Anti-NLRP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NLRP3

Rabbit Polyclonal Anti-IL18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS

Rabbit polyclonal IL-1 beta antibody

Applications WB
Reactivities Human, Primate, Dog
Conjugation Unconjugated
Immunogen This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1).

Rabbit Polyclonal Anti-CARD9 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR