Antibodies

View as table Download

Rabbit anti-IL7R Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL7R

Anti-GHR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 48-63 amino acids of Human growth hormone receptor

Rabbit Polyclonal Anti-GHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHR antibody: synthetic peptide directed towards the N terminal of human GHR. Synthetic peptide located within the following region: LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF