Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Calreticulin Antibody
| Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Interferon beta (IFNB1) rabbit polyclonal antibody
| Applications | ELISA, FN, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
Rabbit Polyclonal LOX propeptide Antibody
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human LOX propeptide (within residues 118-168). [Swiss-Prot# P28300] |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Rabbit anti-GDF15 Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GDF15 |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IP
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Secreted Protein
Filter by
Target Symbol
Reactivities
Isotypes
Conjugates
Assay Types
Pathways
- Complement and coagulation cascades (5)
- Cytokine-cytokine receptor interaction (3)
- Neuroactive ligand-receptor interaction (3)
- Systemic lupus erythematosus (3)
- Endocytosis (2)
- Hematopoietic cell lineage (2)
- Jak-STAT signaling pathway (2)
- Melanogenesis (2)
- Natural killer cell mediated cytotoxicity (2)
- TGF-beta signaling pathway (2)
- Acute myeloid leukemia (1)
- Allograft rejection (1)
- Antigen processing and presentation (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Calcium signaling pathway (1)
- Cytosolic DNA-sensing pathway (1)
- Dilated cardiomyopathy (1)
- Gap junction (1)
- GnRH signaling pathway (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Long-term depression (1)
- Pathways in cancer (1)
- Proteasome (1)
- RIG-I-like receptor signaling pathway (1)
- Regulation of autophagy (1)
- T cell receptor signaling pathway (1)
- Taste transduction (1)
- Toll-like receptor signaling pathway (1)
- Type I diabetes mellitus (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)