Rabbit Polyclonal Antibody against ATG5
| Applications | Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal antibody to SLC25A33 (solute carrier family 25, member 33)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Cow, Sheep) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 114 and 321 of SLC25A33 (Uniprot ID#Q9BSK2) |
Rabbit Polyclonal Antibody against LOX
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 506 and 723 of LETM1 (Uniprot ID#O95202) |
Rabbit Polyclonal Antibody against SAT1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit polyclonal antibody to Cytokeratin 13 (keratin 13)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Cow, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 198 and 438 of Cytokeratin 13 |
Rabbit Polyclonal antibody to Cytokeratin 10 (keratin 10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Cow, Dog, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 73 and 284 of Cytokeratin 10 |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Cow, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688) |
Rabbit Polyclonal antibody to LIMCH1 (LIM and calponin homology domains 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Cow, Zebrafish, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 734 and 1007 of LIMCH1 (Uniprot ID#Q9UPQ0) |
Rabbit polyclonal antibody to Calsequestrin-2 (calsequestrin 2 (cardiac muscle))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Cow, Rabbit, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 124 and 388 of Calsequestrin 2 (Uniprot ID#O14958) |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Cow) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244) |
Germany
Japan
United Kingdom
China
