Rabbit Polyclonal Anti-P2RX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human P2RX2 |
Rabbit Polyclonal Anti-P2RX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human P2RX2 |
Rabbit Polyclonal Anti-P2RX3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human P2RX3 |
Rabbit Polyclonal Anti-P2RX1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RX1 antibody: synthetic peptide directed towards the middle region of human P2RX1. Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG |
Rabbit Polyclonal Anti-P2RX2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK |
P2X3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey, Gibbon (Predicted: Bat, Rabbit) |
Conjugation | Unconjugated |
Immunogen | P2RX3 / P2X3 antibody was raised against synthetic 15 amino acid peptide from C-terminal cytoplasmic domain of human P2RX3 / P2X3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bat, Rabbit, Opossum (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse (87%). |