Antibodies

Jump to Filters
View as table Download
CDC5L Rabbit Polyclonal Antibody
TA349625

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC5L
CDC5L Rabbit Polyclonal Antibody
TA368973

USD 380.00

4 Weeks

CDC5L rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC5L
CDC5L Rabbit Polyclonal Antibody
TA345765

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC5L antibody: synthetic peptide directed towards the middle region of human CDC5L. Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE