Rabbit polyclonal Granzyme B antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Granzyme B. |
Rabbit polyclonal Granzyme B antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Granzyme B. |
Rabbit polyclonal FAS ligand antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FAS ligand. |
Rabbit polyclonal IL4 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
Applications | IHC, WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563) |
Anti-FAS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6) |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
Rabbit polyclonal anti-FAS antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Fas. |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit anti-GZMB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GZMB |
HLA-DOA rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068) |
Anti-GZMB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 21-247 amino acids of human granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) |
Rabbit Polyclonal Anti-TG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TG |
CD95 (FAS) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 280-330 of Human CD95. |