Antibodies

View as table Download

Rabbit polyclonal Granzyme B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Granzyme B.

Rabbit polyclonal FAS ligand antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications IHC, WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

Rabbit anti-GZMB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GZMB

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

Anti-GZMB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-247 amino acids of human granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)

Rabbit Polyclonal Anti-TG Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TG

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.