Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan (Predicted: Bat, Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit polyclonal TTR Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR. |
Rabbit polyclonal antibody to Factor IX (coagulation factor IX)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Dog, Monkey, Pig, Rabbit, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 217 and 453 of Factor IX (Uniprot ID#P00740) |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Gibbon (Predicted: Mouse, Rat, Bat, Hamster, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Human, Monkey, Rabbit, Gibbon (Predicted: Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%). |
Rabbit polyclonal IL4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Rabbit Polyclonal Anti-HSD17B11 Antibody
| Applications | IHC |
| Reactivities | Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Dog, Human, Monkey, Mouse, Opossum, Rat, Pufferfish |
| Conjugation | Unconjugated |
| Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Gibbon, Hamster, Horse (Predicted: Mouse, Rat, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
TLL2 Rabbit Polyclonal (CUB 2 Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Dog, Human, Monkey, Pig, Rat, Gibbon (Predicted: Hamster) |
| Conjugation | Unconjugated |
| Immunogen | TLL2 antibody was raised against synthetic 13 amino acid peptide from CUB 2 domain human TLL2. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Galago, Marmoset, Rat, Dog, Bat, Pig (100%); Gorilla, Hamster, Panda (92%); Mouse, Horse (85%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
WNT6 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Human, Rabbit, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |
WNT8A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gorilla, Human, Monkey, Gibbon, Horse (Predicted: Bovine, Dog) |
| Conjugation | Unconjugated |
| Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%). |
Germany
Japan
United Kingdom
China
