Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CDK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of tyrosine 15 (G-T-YP-G-V). |
CDK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of tyrosine 15 (G-T-YP-G-V). |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
CDK1 pThr161 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC2 around the phosphorylation site of threonine161 (T-Y-TP-H-E). |
CDK1 pThr161 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC2 around the phosphorylation site of threonine161 (T-Y-TP-H-E). |
CDK1 pSer39 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S39 of human CDK1. |
Rabbit Polyclonal Antibody against CDC2 (T14)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
| Modifications | Phospho-specific |
CDK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Tyrosine 19 (V-V-YP-K-G). |
CDK1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-297 of human CDK1 (NP_001777.1). |
| Modifications | Unmodified |
CDK1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1). |
| Modifications | Unmodified |
CDK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Tyrosine 19 (V-V-YP-K-G). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CDK1
Applications
- IHC
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal