TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit polyclonal anti-H3F3B(Histone H3) antibody, Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 86 of Histone H3.3B |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | IF, IHC, IP, WB |
Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Anti-ACTN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1 |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTN4 |
Rabbit Polyclonal Anti-HIST1H2AH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HIST1H2AH |
Rabbit Polyclonal Anti-HIST4H4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HIST4H4 |
Rabbit Polyclonal Anti-HIST1H2AB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIST1H2AB |
Rabbit Polyclonal Anti-SSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SSB |
Rabbit Polyclonal TNF-alpha Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Anti-SSB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 100-105 amino acids of human Sjogren syndrome antigen B (autoantigen La) |
Rabbit polyclonal C1QC Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |