Antibodies

View as table Download

Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR.
Modifications Phospho-specific

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal SQSTM1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SQSTM1 antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human SQSTM1. The immunogen is located within the last 50 amino acids of SQSTM1.

Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains.

Rabbit Polyclonal Anti-EED Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EED antibody: synthetic peptide directed towards the N terminal of human EED. Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC

FOXO3 (221-270) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 221-270 of Human FoxO3A

Rabbit Polyclonal ING1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal IRF7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7.

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L).
Modifications Phospho-specific

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications IF, IHC, IP, WB
Reactivities Human (Predicted: Mouse, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Rabbit Polyclonal antibody to DAP5 (eukaryotic translation initiation factor 4 gamma, 2)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Rabbit, Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 194 of DAP5

Rabbit Polyclonal Antibody against SQSTM1

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This SQSTM1 (p62) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-346 amino acids from the C-terminal region of human SQSTM1 (p62).