Antibodies

Jump to Filters
View as table Download
EED Rabbit Polyclonal Antibody
TA339084

USD 539.00

5 Days

Rabbit Polyclonal Anti-EED Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EED antibody: synthetic peptide directed towards the N terminal of human EED. Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
EED Rabbit Polyclonal Antibody
TA319758

USD 570.00

5 Days

Rabbit Polyclonal EED Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EED antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EED. The immunogen is located within amino acids 30 - 80 of EED.