Primary Antibodies

View as table Download

Rabbit polyclonal CLIC4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4.

CLIC4 mouse monoclonal antibody, clone 17CT9.2.8, Ascites

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against CLIC4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CLIC4 antibody is generated from rabbits immunized with recombinant human CLIC4 protein.

Rabbit Polyclonal Anti-CLIC4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NGLKEEDKEPLIE, corresponding to amino acid residues 8 - 20 of human CLIC4. Intracellular, N-terminus.

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLIC4

Goat Polyclonal Antibody against CLIC4

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence NGLKEEDKEPLIE-C, from the N Terminus of the protein sequence according to NP_039234.1.

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

CLIC4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLIC4

CLIC4 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-253 of human CLIC4 (NP_039234.1).
Modifications Unmodified