Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
LTBR rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
LTBR (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 28-57 amino acids from the N-terminal region of human LTBR |
Rabbit Polyclonal anti-LTBR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY |
Ltbr rat monoclonal antibody, clone 5G11, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Ltbr rat monoclonal antibody, clone 5G11b, Low Endotoxin
| Applications | FC, FN |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Ltbr rat monoclonal antibody, clone 5G11b, Purified
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Ltbr rat monoclonal antibody, clone 5G11b, Purified
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- LTBR