Germany
Japan
United Kingdom
China
PLP1 (C-term) mouse monoclonal antibody, clone plpc1, Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PLP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the N terminal of human PLP1. Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
PLP1 chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a sequence shared between the Mouse (P60202) and Human (NP_000524) gene products. Production: After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. The concentrations of the eluates were then adjusted to 0.1 mg/ml, and the preparation was filter-sterilized. |
Rabbit Polyclonal Anti-PLP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ |
PLP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PLP1