Rabbit polyclonal Anti-Kir3.4 (GIRK4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 .? ? Intracellular, N-terminus. |
Rabbit polyclonal Anti-Kir3.4 (GIRK4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 .? ? Intracellular, N-terminus. |
Rabbit Polyclonal Anti-KCNJ5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNJ5 antibody: synthetic peptide directed towards the N terminal of human KCNJ5. Synthetic peptide located within the following region: AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ |
KCNJ5 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNJ5 |
KCNJ5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3). |
Modifications | Unmodified |
KCNJ5 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the N-term domain of the GIRK4 protein |