Primary Antibodies

View as table Download

Rabbit polyclonal Anti-Kir3.4 (GIRK4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 .? ? Intracellular, N-terminus.

Rabbit Polyclonal Anti-KCNJ5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ5 antibody: synthetic peptide directed towards the N terminal of human KCNJ5. Synthetic peptide located within the following region: AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ

KCNJ5 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNJ5

KCNJ5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3).
Modifications Unmodified

KCNJ5 rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the N-term domain of the GIRK4 protein