KCNH5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNH5 |
KCNH5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNH5 |
Rabbit Polyclonal Anti-KCNH5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNH5 antibody: synthetic peptide directed towards the N terminal of human KCNH5. Synthetic peptide located within the following region: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH |
Rabbit polyclonal Anti-KV10.2 (EAG-2)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EDPKGSDSENSVTKNPLRK,? corresponding to amino acid residues 842-860 of rat Kv10.2? . Intracellular, C-terminus. |