Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Polyclonal Anti-IDH3B (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1. |
Goat Anti-IDH3B (aa369-383) Antibody
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TTDFIKSVIGHLQTK, from the C Terminus of the protein sequence according to NP_008830.2; NP_777281.1. |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: SEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRK |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: RIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKF |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH3B antibody is: synthetic peptide directed towards the C-terminal region of Human IDH3B. Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL |
IDH3B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IDH3B |
Active filters
Target Symbol
- IDH3B