Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Ap3b1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ap3b1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM

AP3B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AP3B1