Rabbit Polyclonal Antibody against FAU (C-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Hamster, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-59 amino acids from the C-terminal region of human FAU. |
Rabbit Polyclonal Anti-FAU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAU antibody: synthetic peptide directed towards the middle region of human FAU. Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS |
Rabbit Polyclonal Antibody against FAU (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FAU. |
FAU Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FAU (NP_001988.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
