Rabbit Polyclonal AIF Antibody
| Applications | ELISA, ICC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AIF antibody was raised against a peptide corresponding to amino acids 593 to 606 of human AIF. This sequence is identical to those of mouse and rat AIF. |
Rabbit polyclonal anti-CNKR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CNKR1. |
Rabbit Polyclonal Anti-CNKSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNKSR1 antibody is: synthetic peptide directed towards the middle region of Human CNKSR1. Synthetic peptide located within the following region: VLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKP |
CNKSR1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CNKSR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CNKSR1 |
Germany
Japan
United Kingdom
China