Primary Antibodies

View as table Download

Goat Anti-CXCR6 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SEDNSKTFSASHN, from the C Terminus of the protein sequence according to NP_006555.1.

Rabbit Polyclonal Anti-CXCR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL