Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Anti-ARF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1

ARF1 mouse monoclonal antibody, clone AT1B3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

ARF1 mouse monoclonal antibody, clone AT1B3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

ARF1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ARF1

ARF1 Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ARF1

Goat Polyclonal Antibody against ARF1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1.

ARF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated

ARF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ARF1
Modifications Unmodified